Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1, Human (His)

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NFKB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nfkb1-protein-human-his.html

Purity

98.0

Smiles

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

Molecular Formula

4790 (Gene_ID) P19838-2 (M1-G434) (Accession)

Molecular Weight

Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lymphoid tissue
CS632853 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
TIM 3 Recombinant Rabbit Monoclonal Antibody [PSH07-75]
HA722891 100 µL

TIM 3 Recombinant Rabbit Monoclonal Antibody [PSH07-75]

Sign In for Pricing
View Details
Recombinant Human CD80 protein (His tag)
PDMH100154-01 20 µg

Recombinant Human CD80 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD80 protein (His tag)
PDMH100154-02 100 µg

Recombinant Human CD80 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD80 protein (His tag)
PDMH100154-03 500 µg

Recombinant Human CD80 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD80 protein (His tag)
PDMH100154-04 1 mg

Recombinant Human CD80 protein (His tag)

Sign In for Pricing
View Details