Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Mouse (CHO)

IL-10 Protein, Mouse (CHO) is a potent CHO cell derived anti-inflammatory cytokine results in increased immune-mediated demyelination in mice infected with a neurotropic coronavirus.

Product Specifications

Product Name Alternative

IL-10 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-mouse-cho.html

Purity

95.00

Smiles

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Trandem K, et al. Virally expressed interleukin-10 ameliorates acute encephalomyelitis and chronic demyelinationin coronavirus-infected mice. J Virol. 2011 Jul;85 (14) :6822-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat GH Matched Antibody Pair Set [ABP-S-04455]
ABP-S-04455 5 Plates

Rat GH Matched Antibody Pair Set [ABP-S-04455]

Sign In for Pricing
View Details
Anti-AR (phospho-S213) Antibody
A00542S213 100 µL

Anti-AR (phospho-S213) Antibody

Sign In for Pricing
View Details
(3-Piperidinophenyl) methylamine
orb3031256-01 200 mg

(3-Piperidinophenyl) methylamine

Sign In for Pricing
View Details
(3-Piperidinophenyl) methylamine
orb3031256-02 5 mg

(3-Piperidinophenyl) methylamine

Sign In for Pricing
View Details
(3-Piperidinophenyl) methylamine
orb3031256-03 25 mg

(3-Piperidinophenyl) methylamine

Sign In for Pricing
View Details
Mmu-miR-7650-5p miRNA Antagomir
orb1911972-01 10 nmol

Mmu-miR-7650-5p miRNA Antagomir

Sign In for Pricing
View Details