Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Rat (HEK293)

The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

M-CSF Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-rat-hek-293.html

Purity

98.0

Smiles

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR

Molecular Formula

78965 (Gene_ID) Q8JZQ0-1 (E33-R254) (Accession)

Molecular Weight

Approximately 46.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PLSCR4 Antibody [HRP]
NBP2-97270H 0.1 mL

Rabbit Polyclonal PLSCR4 Antibody [HRP]

Sign In for Pricing
View Details
Hsp70-derived octapeptide
HY-P1896-01 5 mg

Hsp70-derived octapeptide

Sign In for Pricing
View Details
Hsp70-derived octapeptide
HY-P1896-02 10 mg

Hsp70-derived octapeptide

Sign In for Pricing
View Details
OPA3 Recombinant Protein
OPCD00316-10UG 10 µg

OPA3 Recombinant Protein

Sign In for Pricing
View Details
TAPBP Antibody
GWB-78BCE2 0.05 mg

TAPBP Antibody

Sign In for Pricing
View Details
Rat Stem Cell Factor (SCF) Antibody Pair Kit (with Standard)
MBS2098470-01 5x 96 Tests

Rat Stem Cell Factor (SCF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details