Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin 2 Antibody / PHB2
RQ6364 100 µg

Prohibitin 2 Antibody / PHB2

Sign In for Pricing
View Details
Human Monoclonal Integrin alpha 5 beta 1 Antibody (volociximab) [Janelia Fluor 585]
NBP3-28753JF585 0.1 mL

Human Monoclonal Integrin alpha 5 beta 1 Antibody (volociximab) [Janelia Fluor 585]

Sign In for Pricing
View Details
Human SDF-1 alpha (CXCL12)
MBS691566-01 0.002 mg

Human SDF-1 alpha (CXCL12)

Sign In for Pricing
View Details
Human SDF-1 alpha (CXCL12)
MBS691566-02 0.01 mg

Human SDF-1 alpha (CXCL12)

Sign In for Pricing
View Details
Human SDF-1 alpha (CXCL12)
MBS691566-03 5x 0.01 mg

Human SDF-1 alpha (CXCL12)

Sign In for Pricing
View Details
Mtnr1b Mouse shRNA Lentiviral Particle (Locus ID 244701)
TL515287V 500 µL Each

Mtnr1b Mouse shRNA Lentiviral Particle (Locus ID 244701)

Sign In for Pricing
View Details