Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62451R-BF405-01 20 µL

GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62451R-BF405-02 100 µL

GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Poly (rC) -binding protein 2 Antibody / PCBP2 / hnRNP E2
RQ7038 100 µg

Poly (rC) -binding protein 2 Antibody / PCBP2 / hnRNP E2

Sign In for Pricing
View Details
Bloc1s6 Rat shRNA Lentiviral Particle (Locus ID 317630)
TL703026V 500 µL Each

Bloc1s6 Rat shRNA Lentiviral Particle (Locus ID 317630)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae DNA polymerase III subunit beta (dnaN)
MBS1205119-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae DNA polymerase III subunit beta (dnaN)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae DNA polymerase III subunit beta (dnaN)
MBS1205119-02 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae DNA polymerase III subunit beta (dnaN)

Sign In for Pricing
View Details