Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sturnira lilium Cytochrome b (MT-CYB), partial
MBS7077960 Inquire

Recombinant Sturnira lilium Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
Lentiviral mouse Lrrfip2 shRNA (UAS) - Lentiviral mouse Lrrfip2 shRNA (UAS, RFP) (25)
GTR15257627 1 Vial

Lentiviral mouse Lrrfip2 shRNA (UAS) - Lentiviral mouse Lrrfip2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal SMC4 Antibody [Alexa Fluor 405]
NBP2-97937AF405 0.1 mL

Rabbit Polyclonal SMC4 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Cytomegalovirus Envelope glycoprotein 1, His, Yeast-200ug
QP7456-ye-200ug 200ug

Recombinant Cytomegalovirus Envelope glycoprotein 1, His, Yeast-200ug

Sign In for Pricing
View Details
1,4-Bis(p-tolylamino)anthracene-9,10-dione
TRC-P768855-250MG 250 mg

1,4-Bis(p-tolylamino)anthracene-9,10-dione

Sign In for Pricing
View Details
Gdpd3 (BC002172) Mouse Untagged Clone
MC218403 10 µg

Gdpd3 (BC002172) Mouse Untagged Clone

Sign In for Pricing
View Details