CD299, Human (HEK293, His-Flag)
CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.
Product Specifications
Product Name Alternative
CD299 Protein, Human (HEK293, His-Flag), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html
Purity
95.0
Smiles
SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Molecular Formula
10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)
Molecular Weight
35-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
E6335Hu-01 48 Well
Human Tubulointerstitial nephritis antigen, TINAG ELISA KIT
Sign In for Pricing
View Details 
E6335Hu-02 96 Well
Human Tubulointerstitial nephritis antigen, TINAG ELISA KIT
Sign In for Pricing
View Details 
E6335Hu-03 5x 96 Tests
Human Tubulointerstitial nephritis antigen, TINAG ELISA KIT
Sign In for Pricing
View Details 
E6335Hu-04 10x 96 Tests
Human Tubulointerstitial nephritis antigen, TINAG ELISA KIT
Sign In for Pricing
View Details ELI-24152m 96 Tests
Mouse Aurora kinase A-interacting protein, Aurkaip1 ELISA KIT
Sign In for Pricing
View Details SC212062 10 µg
beta V TubuLin (TUBB) (NM_178014) Human 3' UTR Clone
Sign In for Pricing
View Details