Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBP Recombinant Protein (Rat)
RP211046 100 µg

MBP Recombinant Protein (Rat)

Sign In for Pricing
View Details
ACOT4 Protein Vector (Human) (pPM-N-D-C-HA)
PV319244 500 ng

ACOT4 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Lawsone methyl ether 50mg
A22394-50 50 mg

Lawsone methyl ether 50mg

Sign In for Pricing
View Details
SLC11A2 Antibody, HRP conjugated
MBS7105110-01 0.05 mg

SLC11A2 Antibody, HRP conjugated

Sign In for Pricing
View Details
SLC11A2 Antibody, HRP conjugated
MBS7105110-02 0.1 mg

SLC11A2 Antibody, HRP conjugated

Sign In for Pricing
View Details
SLC11A2 Antibody, HRP conjugated
MBS7105110-03 5x 0.1 mg

SLC11A2 Antibody, HRP conjugated

Sign In for Pricing
View Details