Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, His-Flag)

CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek-293-his-flag.html

Purity

95.0

Smiles

SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-8 (S73-E376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RASSF1A Recombinant Protein
PROTQ9NS23-100ug 100 µg

Human RASSF1A Recombinant Protein

Sign In for Pricing
View Details
NFH (NEFH) Mouse Monoclonal Antibody [Clone ID: OTI6F11]
TA801163 100 µL

NFH (NEFH) Mouse Monoclonal Antibody [Clone ID: OTI6F11]

Sign In for Pricing
View Details
HAO2 Antibody, HRP conjugated
MBS7053302-01 0.05 mg

HAO2 Antibody, HRP conjugated

Sign In for Pricing
View Details
HAO2 Antibody, HRP conjugated
MBS7053302-02 0.1 mg

HAO2 Antibody, HRP conjugated

Sign In for Pricing
View Details
HAO2 Antibody, HRP conjugated
MBS7053302-03 5x 0.1 mg

HAO2 Antibody, HRP conjugated

Sign In for Pricing
View Details
DDX26 (INTS6) (NM_001039937) Human Tagged Lenti ORF Clone
RC215792L4 10 µg

DDX26 (INTS6) (NM_001039937) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details