Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Mouse (His)

The Matriptase/ST14 catalytic domain protein exhibits serine-type endopeptidase activity and is critical in processes as diverse as placental branching and neural tube closure. It is an extrinsic component of the plasma membrane and is expressed in structures such as the digestive system, early concepts, genitourinary system, pituitary gland, and sense organs. Matriptase/ST14 Catalytic Domain Protein, Mouse (His) is the recombinant mouse-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-mouse-his.html

Purity

97.00

Smiles

GSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLMPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTRLPVVRDWIKEHTGV

Molecular Formula

19143 (Gene_ID) NP_035306 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPAG17 activation kit by CRISPRa
GA116337 1 Kit

Human SPAG17 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human INPP5F activation kit by CRISPRa
GA107874 1 Kit

Human INPP5F activation kit by CRISPRa

Sign In for Pricing
View Details
IL31 (N-term) Rabbit Polyclonal Antibody
AP52198PU-N 400 µL

IL31 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDR2 Recombinant Rabbit Monoclonal Antibody [JE31-45]
HA721479 100 µL

DDR2 Recombinant Rabbit Monoclonal Antibody [JE31-45]

Sign In for Pricing
View Details
Glycine-2-13C Ethyl Ester Hydrochloride
TRC-G625227-25MG 25 mg

Glycine-2-13C Ethyl Ester Hydrochloride

Sign In for Pricing
View Details