Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fatty acid-binding protein, liver protein (Fabp1) (Active)

Product Specifications

Product Name Alternative

14 kDa selenium-binding protein, Liver-type fatty acid-binding protein, L-FABP

Abbreviation

Recombinant Mouse Fabp1 protein (Active)

Gene Name

Fabp1

UniProt

P12710

Expression Region

1-127aa

Organism

Mus musculus (Mouse)

Target Sequence

MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Signal Transduction

Relevance

Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. Also seems to bind selenium.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant WNV (lineage 1, strain NY99) E / Envelope Protein (Domain III, His Tag)
PKSV030259 100 µg

Recombinant WNV (lineage 1, strain NY99) E / Envelope Protein (Domain III, His Tag)

Sign In for Pricing
View Details
CIAO1 (NM_004804) Human Recombinant Protein
TP307586 20 µg

CIAO1 (NM_004804) Human Recombinant Protein

Sign In for Pricing
View Details
HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF647 conjugate, 0.1mg/mL
BNC471656-100 1x 100 µL

HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D2HGDH (NM_152783) Human Recombinant Protein
TP307367M 100 µg

D2HGDH (NM_152783) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-CD86 (GL1) In Vivo Antibody - Low Endotoxin
ICH1038-50mg 50 mg

Anti-CD86 (GL1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
2,5-Dihydroxybenzoic Acid
TRC-D451655-250MG 250 mg

2,5-Dihydroxybenzoic Acid

Sign In for Pricing
View Details