Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf33/MRTO4, Human (His)

C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

C1orf33/MRTO4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1orf33-mrto4-protein-human-his.html

Purity

98.0

Smiles

MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD

Molecular Formula

51154 (Gene_ID) Q9UKD2 (M1-D239) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Somatostatin Receptor 1/SSTR1 Rabbit Polyclonal Antibody (Fluoro550)
orb3082133 100 µg

Somatostatin Receptor 1/SSTR1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
S400-Bio kit pH meter + InLab Routine Pro-ISM cable kit
PHM8006 1 Each

S400-Bio kit pH meter + InLab Routine Pro-ISM cable kit

Sign In for Pricing
View Details
ATF4 Rabbit Polyclonal Antibody (Carrier-free)
orb3118716 100 µg

ATF4 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Human Interleukin-4, IL4 ELISA Kit
BPE392-01 96 Tests

Human Interleukin-4, IL4 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-4, IL4 ELISA Kit
BPE392-02 5x 96 Tests

Human Interleukin-4, IL4 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-4, IL4 ELISA Kit
BPE392-03 15 x 96 Tests

Human Interleukin-4, IL4 ELISA Kit

Sign In for Pricing
View Details