Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Rat (CHO)

IL-10 Protein, Rat (CHO) is a CHO cell derived immunosuppressive cytokine produced by a variety of mammalian cell types including macophages, monocytes, B-cells, T-cells and keratinocytes.

Product Specifications

Product Name Alternative

IL-10 Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-rat-cho.html

Purity

95.00

Smiles

SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN

Molecular Formula

25325 (Gene_ID) P29456 (S19-N178) (Accession)

Molecular Weight

Approximately 8-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Ball C, et al. Rat interleukin-10: production and characterisation of biologically active protein in a recombinantbacterial expression system. Eur Cytokine Netw. 2001 Mar;12 (1) :187-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-BOC-4-Bromoindole
TRC-B200943-2.5G 2.5 g

1-BOC-4-Bromoindole

Sign In for Pricing
View Details
Human CD16 Recombinant Mouse monoclonal Antibody
HA601340 100 µL

Human CD16 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
TruScript First Strand cDNA Synthesis Kit
54420 50 Reactions

TruScript First Strand cDNA Synthesis Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501152 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
TRF41 (PAPD7) Rabbit Polyclonal Antibody
TA379622 100 µL

TRF41 (PAPD7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP9 Human Gene Knockout Kit (CRISPR)
KN402872 1 Kit

MMP9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details