Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RWDD4A Antibody
GWB-MS910A 50 µg

RWDD4A Antibody

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) SPIN Polyclonal Antibody
MBS9011819 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) SPIN Polyclonal Antibody

Sign In for Pricing
View Details
ALG13 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV680748 1.0 µg DNA

ALG13 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
RGS14 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV690905 1.0 µg DNA

RGS14 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
LRPAP1 Protein Vector (Human) (pPB-C-His)
PV092374 500 ng

LRPAP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ARG1, NT (A I, Al, ARG 1, ARGI1_HUMAN, Arginase 1, Arginase Liver, Arginase Type I, Arginase-1, Arginase1, Liver Type Arginase, Liver-type Arginase, Type I Arginase)
303128 100 µg

ARG1, NT (A I, Al, ARG 1, ARGI1_HUMAN, Arginase 1, Arginase Liver, Arginase Type I, Arginase-1, Arginase1, Liver Type Arginase, Liver-type Arginase, Type I Arginase)

Sign In for Pricing
View Details