Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnajc22 ORF Vector (Mouse) (pORF)
ORF043193 1.0 µg DNA

Dnajc22 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Prtfdc1 (NM_001106127) Rat Tagged ORF Clone Lentiviral Particle
RR201500L4V 200 µL

Prtfdc1 (NM_001106127) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Protein Serine Kinase H2 (PSKH2) Antibody
abx218032-01 50 µg

Protein Serine Kinase H2 (PSKH2) Antibody

Sign In for Pricing
View Details
Protein Serine Kinase H2 (PSKH2) Antibody
abx218032-02 100 µg

Protein Serine Kinase H2 (PSKH2) Antibody

Sign In for Pricing
View Details
RACGAP1 (Rac GTPase-activating Protein 1, Male Germ Eell RacGap, MgcRacGAP, CYK4, HsCYK-4, ID-GAP, KIAA1478, Protein CYK4 Homolog) APC
MBS6138592-01 0.1 mL

RACGAP1 (Rac GTPase-activating Protein 1, Male Germ Eell RacGap, MgcRacGAP, CYK4, HsCYK-4, ID-GAP, KIAA1478, Protein CYK4 Homolog) APC

Sign In for Pricing
View Details
RACGAP1 (Rac GTPase-activating Protein 1, Male Germ Eell RacGap, MgcRacGAP, CYK4, HsCYK-4, ID-GAP, KIAA1478, Protein CYK4 Homolog) APC
MBS6138592-02 5x 0.1 mL

RACGAP1 (Rac GTPase-activating Protein 1, Male Germ Eell RacGap, MgcRacGAP, CYK4, HsCYK-4, ID-GAP, KIAA1478, Protein CYK4 Homolog) APC

Sign In for Pricing
View Details