Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YebF, E.coli (Myc, His)

YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

YebF Protein, E.coli (Myc, His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/yebf-protein-e-coli-myc-his.html

Smiles

ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR

Molecular Formula

946363 (Gene_ID) P33219 (A22-R118) (Accession)

Molecular Weight

Approximately 15.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RNF2 (RING Finger Protein 2, BAP-1, BAP1, DING, HIPI3, Ring1B, Ring2) (MaxLight 405)
MBS6197661-01 0.1 mL

RNF2 (RING Finger Protein 2, BAP-1, BAP1, DING, HIPI3, Ring1B, Ring2) (MaxLight 405)

Ask
View Details
RNF2 (RING Finger Protein 2, BAP-1, BAP1, DING, HIPI3, Ring1B, Ring2) (MaxLight 405)
MBS6197661-02 5x 0.1 mL

RNF2 (RING Finger Protein 2, BAP-1, BAP1, DING, HIPI3, Ring1B, Ring2) (MaxLight 405)

Ask
View Details
BTBD8 Human qPCR Primer Pair (NM_183242)
HP219214 200 Reactions

BTBD8 Human qPCR Primer Pair (NM_183242)

Ask
View Details
LOC690478 (NM_001109595) Rat Tagged Lenti ORF Clone
RR206415L3 10 µg

LOC690478 (NM_001109595) Rat Tagged Lenti ORF Clone

Ask
View Details
RPS10P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
42035061 1.0 µg DNA

RPS10P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details