Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury[2].

Product Specifications

Product Name Alternative

Serpin A1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a1-protein-human-hek293-his.html

Purity

98.0

Smiles

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHH

Molecular Formula

5265 (Gene_ID) AAH11991.1 (E25-K418) (Accession)

Molecular Weight

50-65 kDa

References & Citations

[1]Hunt JM, et al. Alpha 1 anti-trypsin: one protein, many functions. Curr Mol Med. 2012 Aug;12 (7) :827-35.|[2]Yehudit Shabat, et al. Alpha-1 Anti-trypsin Exerts a Hepatoprotective Effect on Immune-mediated Hepatitis and Acetaminophen-induced Liver Injury. J Clin Transl Hepatol. 2018 Dec 28;6 (4) :345-349.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

bcl 6 (BCL6) (NM_001130845) Human Over-expression Lysate
LC427282 20 µg

bcl 6 (BCL6) (NM_001130845) Human Over-expression Lysate

Sign In for Pricing
View Details
BLVRB Protein, Human, Recombinant (His Tag)
PH51759E1 50 µg

BLVRB Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
BCAM Protein, Human, Recombinant (C-His)
E51P01151 100 µg

BCAM Protein, Human, Recombinant (C-His)

Sign In for Pricing
View Details
CFAP47 Human shRNA Lentiviral Particle (Locus ID 286464)
TL307746V 500 µL Each

CFAP47 Human shRNA Lentiviral Particle (Locus ID 286464)

Sign In for Pricing
View Details
Fshr sgRNA CRISPR Lentivector (Rat) (Target 1)
K6784302 1.0 µg DNA

Fshr sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
RUNDC3A Antibody (YA8675, Mouse)
HY-P88991 1 Each

RUNDC3A Antibody (YA8675, Mouse)

Sign In for Pricing
View Details