Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury[2].

Product Specifications

Product Name Alternative

Serpin A1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a1-protein-human-hek293-his.html

Purity

98.0

Smiles

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHH

Molecular Formula

5265 (Gene_ID) AAH11991.1 (E25-K418) (Accession)

Molecular Weight

50-65 kDa

References & Citations

[1]Hunt JM, et al. Alpha 1 anti-trypsin: one protein, many functions. Curr Mol Med. 2012 Aug;12 (7) :827-35.|[2]Yehudit Shabat, et al. Alpha-1 Anti-trypsin Exerts a Hepatoprotective Effect on Immune-mediated Hepatitis and Acetaminophen-induced Liver Injury. J Clin Transl Hepatol. 2018 Dec 28;6 (4) :345-349.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Human BTLA CHO-K1 Cell Line, Binding assay
S01YF-1022-KX137 1 Vial

Magic™ Human BTLA CHO-K1 Cell Line, Binding assay

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)
MBS2083701-01 0.1 mL

APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)
MBS2083701-02 0.2 mL

APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)
MBS2083701-03 0.5 mL

APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)
MBS2083701-04 1 mL

APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)
MBS2083701-05 5 mL

APC-Linked Polyclonal Antibody to R-Spondin 1 (RSPO1)

Sign In for Pricing
View Details