Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury[2].

Product Specifications

Product Name Alternative

Serpin A1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a1-protein-human-hek293-his.html

Purity

98.0

Smiles

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHH

Molecular Formula

5265 (Gene_ID) AAH11991.1 (E25-K418) (Accession)

Molecular Weight

50-65 kDa

References & Citations

[1]Hunt JM, et al. Alpha 1 anti-trypsin: one protein, many functions. Curr Mol Med. 2012 Aug;12 (7) :827-35.|[2]Yehudit Shabat, et al. Alpha-1 Anti-trypsin Exerts a Hepatoprotective Effect on Immune-mediated Hepatitis and Acetaminophen-induced Liver Injury. J Clin Transl Hepatol. 2018 Dec 28;6 (4) :345-349.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken SRSF1 ELISA Kit
E098843 1 Each

Chicken SRSF1 ELISA Kit

Sign In for Pricing
View Details
RPL11P3 sgRNA CRISPR Lentivector set (Human)
K1901201 3x 1.0 µg

RPL11P3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal FSH beta Antibody (FSHb/2033R) [DyLight 755]
NBP3-08577IR 100 µL

Rabbit Monoclonal FSH beta Antibody (FSHb/2033R) [DyLight 755]

Sign In for Pricing
View Details
Rhophilin (h) : 293T Lysate
sc-114163 100 µg - 200 µL

Rhophilin (h) : 293T Lysate

Sign In for Pricing
View Details
DUSP1 (Dual Specificity Phosphatase 1, CL100, HVH1, MKP-1, MKP1, PTPN10) (MaxLight 490)
245523-ML490 100 µL

DUSP1 (Dual Specificity Phosphatase 1, CL100, HVH1, MKP-1, MKP1, PTPN10) (MaxLight 490)

Sign In for Pricing
View Details
Guanine nucleotide-binding protein G (GNAL) Mouse ELISA Kit
D8984 96 Tests

Guanine nucleotide-binding protein G (GNAL) Mouse ELISA Kit

Sign In for Pricing
View Details