Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury[2].

Product Specifications

Product Name Alternative

Serpin A1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a1-protein-human-hek293-his.html

Purity

98.0

Smiles

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHH

Molecular Formula

5265 (Gene_ID) AAH11991.1 (E25-K418) (Accession)

Molecular Weight

50-65 kDa

References & Citations

[1]Hunt JM, et al. Alpha 1 anti-trypsin: one protein, many functions. Curr Mol Med. 2012 Aug;12 (7) :827-35.|[2]Yehudit Shabat, et al. Alpha-1 Anti-trypsin Exerts a Hepatoprotective Effect on Immune-mediated Hepatitis and Acetaminophen-induced Liver Injury. J Clin Transl Hepatol. 2018 Dec 28;6 (4) :345-349.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTK Protein Vector (Human) (pPB-C-His)
PV092698 500 ng

LTK Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
RPL30P6 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV779428 1.0 µg DNA

RPL30P6 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Olfr860 (NM_146528) AAV Particle
MR212872A1V 250 µL

Mouse Olfr860 (NM_146528) AAV Particle

Sign In for Pricing
View Details
Bovine FGF4 ELISA Kit
E083322 1 Each

Bovine FGF4 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human GGH shRNA (UAS) - Lentiviral human GGH shRNA (UAS) plasmid
GTR15101575 1 Vial

Lentiviral human GGH shRNA (UAS) - Lentiviral human GGH shRNA (UAS) plasmid

Sign In for Pricing
View Details
VRK3 Overexpression Lysate (Native) - (Dry Ice)
NBP2-07047 0.1 mg

VRK3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details