Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Profilin-2, Human (His)

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Profilin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/profilin-2-protein-human-his.html

Purity

95.0

Smiles

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Molecular Formula

5217 (Gene_ID) AAH18049.1 (M1-F140) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF640R conjugate, 0.1mg/mL
BNC401946-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL
BNC941266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JX 401
SIH-454-50MG 50 mg

JX 401

Sign In for Pricing
View Details
SQSTM1 (NM_001142298) Human Over-expression Lysate
LC428020 20 µg

SQSTM1 (NM_001142298) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF812P Human Gene Knockout Kit (CRISPR)
KN434148 1 Kit

ZNF812P Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF807173 100 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details