Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 alpha/CXCL12, Human

SDF-1 alpha (CXCL12α) belongs to the CXC chemokine family and is encoded by the CXCL12 gene. SDF-1 alpha mediates cell chemotaxis and tissue repair through CXCR4/CXCR7, activates AMPK to inhibit NLRP3 inflammasome and pyroptosis; SDF-1 alpha promotes autophagy through the PI3K-mTOR pathway, is induced by upstream inflammatory factors such as TNF-α, and recruits integrins downstream to promote cell adhesion[1]. SDF-1 alpha/CXCL12 Protein, Human is the recombinant human-derived SDF-1 alpha/CXCL12 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

SDF-1 alpha/CXCL12 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sdf-1-alpha-cxcl12-protein-human.html

Purity

98.0

Smiles

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Formula

6387 (Gene_ID) P48061-2 (K22-K89) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[5]Hoh BL, et al. Stromal cell-derived factor-1 promoted angiogenesis and inflammatory cell infiltration in aneurysm walls. J Neurosurg. 2014 Jan;120 (1) :73-86.|[1]Wang S, et al. Exogenous stromal cell-derived factor-1 (SDF-1) suppresses the NLRP3 inflammasome and inhibits pyroptosis in synoviocytes from osteoarthritic joints via activation of the AMPK signaling pathway. Inflammopharmacology. 2021 Jun;29 (3) :695-704.|[2]Hayakawa J, et al. Dextran sulfate and stromal cell derived factor-1 promote CXCR4 expression and improve bone marrow homing efficiency of infused hematopoietic stem cells. J Nippon Med Sch. 2009 Aug;76 (4) :198-208.|[3]Warner JA, et al. Human cytomegalovirus infection inhibits CXCL12- mediated migration and invasion of human extravillous cytotrophoblasts. Virol J. 2012 Nov 1;9:255.|[4]Yadav SS, et al. CXCL12 is a key regulator in tumor microenvironment of cervical cancer: an in vitro study. Clin Exp Metastasis. 2016 Jun;33 (5) :431-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lin28 (LIN28A) (1-5) Rabbit Polyclonal Antibody
AP26066PU-S 50 µL

Lin28 (LIN28A) (1-5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDK5 (NM_004935) Human Over-expression Lysate
LY401536 100 µg

CDK5 (NM_004935) Human Over-expression Lysate

Sign In for Pricing
View Details
Water Chiller BCHI-305
BCHI-305 Each

Water Chiller BCHI-305

Sign In for Pricing
View Details
Bcl-6 Recombinant Rabbit Monoclonal Antibody [JB18-48]
ET7107-80 100 µL

Bcl-6 Recombinant Rabbit Monoclonal Antibody [JB18-48]

Sign In for Pricing
View Details
AFRed 780 Anti-Mouse CD8a Antibody
RD30255F-01 25 µg

AFRed 780 Anti-Mouse CD8a Antibody

Sign In for Pricing
View Details
AFRed 780 Anti-Mouse CD8a Antibody
RD30255F-02 100 µg

AFRed 780 Anti-Mouse CD8a Antibody

Sign In for Pricing
View Details