Siglec-15, Human (HEK293, mFc)
The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html
Purity
95.0
Smiles
FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Molecular Formula
284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)
Molecular Weight
50-70 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6274119-01 0.2 mL
AP3M1, CT (AP3M1, AP-3 complex subunit mu-1, AP-3 adapter complex mu3A subunit, Adapter-related protein complex 3 mu-1 subunit, Mu-adaptin 3A, Mu3A-adaptin) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6274119-02 5x 0.2 mL
AP3M1, CT (AP3M1, AP-3 complex subunit mu-1, AP-3 adapter complex mu3A subunit, Adapter-related protein complex 3 mu-1 subunit, Mu-adaptin 3A, Mu3A-adaptin) (Azide free) (HRP)
Sign In for Pricing
View Details 146831 100 µg
EZH1 (Histone-lysine N-methyltransferase EZH1, ENX-2, Enhancer of Zeste Homolog 1, KIAA0388)
Sign In for Pricing
View Details 