Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB5, ID (HLA-DRB5, HLA class II histocompatibility antigen, DR beta 5 chain, DR beta-5, DR2-beta-2, Dw2, MHC class II antigen DRB5)
036626 200 µL

HLA-DRB5, ID (HLA-DRB5, HLA class II histocompatibility antigen, DR beta 5 chain, DR beta-5, DR2-beta-2, Dw2, MHC class II antigen DRB5)

Sign In for Pricing
View Details
CES1 Rabbit pAb
A1853-01 20 µL

CES1 Rabbit pAb

Sign In for Pricing
View Details
CES1 Rabbit pAb
A1853-02 100 μL

CES1 Rabbit pAb

Sign In for Pricing
View Details
CES1 Rabbit pAb
A1853-03 500 μL

CES1 Rabbit pAb

Sign In for Pricing
View Details
CES1 Rabbit pAb
A1853-04 1000 μL

CES1 Rabbit pAb

Sign In for Pricing
View Details
anti-EIF3S5
YF-PA15775 50 ug

anti-EIF3S5

Sign In for Pricing
View Details