Siglec-15, Human (HEK293, mFc)
The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html
Purity
95.0
Smiles
FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Molecular Formula
284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)
Molecular Weight
50-70 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS028650-01 48 Well
Rat Von Willebrand Factor Cleaving Protease ELISA Kit
Sign In for Pricing
View Details 
MBS028650-02 96 Well
Rat Von Willebrand Factor Cleaving Protease ELISA Kit
Sign In for Pricing
View Details 
MBS028650-03 5x 96 Well
Rat Von Willebrand Factor Cleaving Protease ELISA Kit
Sign In for Pricing
View Details MBS028650-04 10x 96 Well
Rat Von Willebrand Factor Cleaving Protease ELISA Kit
Sign In for Pricing
View Details K1049205 3x 1.0 µg
IGHVIV-44-1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details K6874307 1.0 µg DNA
Stx8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details