Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOCK9-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV723296 1.0 µg DNA

DOCK9-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
PDX1 Mouse Monoclonal Antibody [Clone ID: OTI1E1]
TA807312S 30 µL

PDX1 Mouse Monoclonal Antibody [Clone ID: OTI1E1]

Sign In for Pricing
View Details
Rabbit Polyclonal IER3 Antibody [Janelia Fluor 549]
NBP1-76802JF549 0.1 mL

Rabbit Polyclonal IER3 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
4921530L21Rik Mouse qPCR Template Standard (NM_025733)
MK204303 1 Kit

4921530L21Rik Mouse qPCR Template Standard (NM_025733)

Sign In for Pricing
View Details
Type I Inositol 1,4,5-Trisphosphate 5-Phosphatase (INPP5A) Antibody
abx002349-01 60 µL

Type I Inositol 1,4,5-Trisphosphate 5-Phosphatase (INPP5A) Antibody

Sign In for Pricing
View Details
Type I Inositol 1,4,5-Trisphosphate 5-Phosphatase (INPP5A) Antibody
abx002349-02 120 µL

Type I Inositol 1,4,5-Trisphosphate 5-Phosphatase (INPP5A) Antibody

Sign In for Pricing
View Details