Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor mmu-miR-7672-5p AAV miRNA Vector
Amm3186900 500 ng

Inhibitor mmu-miR-7672-5p AAV miRNA Vector

Sign In for Pricing
View Details
BTK-IN-23
HY-148594 1 Each

BTK-IN-23

Sign In for Pricing
View Details
C643 Cell Complete Medium
CM-0648 4x 125 mL

C643 Cell Complete Medium

Sign In for Pricing
View Details
P-p70 S6 kinase beta 2 (S370) Rabbit Monoclonal Antibody
E49Y9562 100 µL

P-p70 S6 kinase beta 2 (S370) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MYH10 Antibody / non-muscle Myosin IIB
RQ5694 100 µg

MYH10 Antibody / non-muscle Myosin IIB

Sign In for Pricing
View Details
Human ADAM29 shRNA Plasmid
abx957582-01 150 µg

Human ADAM29 shRNA Plasmid

Sign In for Pricing
View Details