Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-378a-3p antagomir
HY-RI03113A-01 5 nmol

Mmu-miR-378a-3p antagomir

Sign In for Pricing
View Details
Mmu-miR-378a-3p antagomir
HY-RI03113A-02 20 nmol

Mmu-miR-378a-3p antagomir

Sign In for Pricing
View Details
Mouse SFRP5 (Secreted Frizzled Related Protein 5) ELISA Kit
EK245517 96 Well

Mouse SFRP5 (Secreted Frizzled Related Protein 5) ELISA Kit

Sign In for Pricing
View Details
Olfr657 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4213402 1.0 µg DNA

Olfr657 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rat Phospho-JAK1 (Tyr1022), p-Jak1 ELISA Kit
MBS1608709-01 48 Well

Rat Phospho-JAK1 (Tyr1022), p-Jak1 ELISA Kit

Sign In for Pricing
View Details
Rat Phospho-JAK1 (Tyr1022), p-Jak1 ELISA Kit
MBS1608709-02 96 Well

Rat Phospho-JAK1 (Tyr1022), p-Jak1 ELISA Kit

Sign In for Pricing
View Details