Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nalgene Bottle 30ml PC Square Media
BOT3630 12 / PCK

Nalgene Bottle 30ml PC Square Media

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-202
BCPS-202 1 Unit

Large Capacity Water Purification System BCPS-202

Sign In for Pricing
View Details
Human ADRA2C qPCR Primer Pair
QH10017S 200 Tests

Human ADRA2C qPCR Primer Pair

Sign In for Pricing
View Details
ETFB Rabbit Polyclonal Antibody
MBS9465346-01 0.05 mL

ETFB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ETFB Rabbit Polyclonal Antibody
MBS9465346-02 0.1 mL

ETFB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ETFB Rabbit Polyclonal Antibody
MBS9465346-03 5x 0.1 mL

ETFB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details