Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DRB3 Rabbit pAb (APR22695N)

Product Specifications

Background

HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-DRB3 Rabbit pAb (APR22695N) .

Synonyms

HLA-DRB3; HLA-DR1B; HLA-DR3B; major histocompatibility complex; class II; DR beta 3

Gene ID

3125

UniProt

P79483

Cellular Locus

Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Late endosome membrane, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3125

Uniprot URL

https://www.uniprot.org/uniprot/P79483

AA Sequence

GDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ham's F-12 Medium with Pen-Strep
abx705100 500 mL

Ham's F-12 Medium with Pen-Strep

Ask
View Details
STAU2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
45704156 3x 1.0 µg DNA

STAU2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details
Porcine Extracellular Signal Regulated Kinase (ERK) ELISA Kit
NSL0657Po 96 Tests

Porcine Extracellular Signal Regulated Kinase (ERK) ELISA Kit

Ask
View Details