Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corticotropin Releasing Factor, human, rat

Product Specifications

Synonyms

Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser- Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2; H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Molecular Formula

C208H344N60O63S2

Molecular Weight

4,757.44 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Klebsiella Pneumoniae lpoA Protein (aa 1-702)
VAng-Cr5045-inquire Inquire

Recombinant Klebsiella Pneumoniae lpoA Protein (aa 1-702)

Sign In for Pricing
View Details
GAPDH Rabbit Polyclonal Antibody
TA319654 100 µg

GAPDH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Bclaf3 Pre-designed siRNA Set B
SI101392B 1 Each

Mouse Bclaf3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, right
CS715537 5x 5 µm

Tissue FFPE Sections, Breast, right

Sign In for Pricing
View Details
RN5S196 AAV Vector (Human) (CMV)
39758101 1 µg

RN5S196 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit anti-eIF4A1 Antibody
DL96043A-01 50 µL

Rabbit anti-eIF4A1 Antibody

Sign In for Pricing
View Details