Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP-38, amide, frog

Product Specifications

Synonyms

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln- Arg-Ile-Lys-Asn-Lys-NH2; H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2

Molecular Formula

C204H333N63O53S

Molecular Weight

4,548.38 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGF, Human (HEK293, N-hFc)
HY-P72982A-01 2 µg

EGF, Human (HEK293, N-hFc)

Sign In for Pricing
View Details
EGF, Human (HEK293, N-hFc)
HY-P72982A-02 5 µg

EGF, Human (HEK293, N-hFc)

Sign In for Pricing
View Details
EGF, Human (HEK293, N-hFc)
HY-P72982A-03 10 µg

EGF, Human (HEK293, N-hFc)

Sign In for Pricing
View Details
EGF, Human (HEK293, N-hFc)
HY-P72982A-04 50 µg

EGF, Human (HEK293, N-hFc)

Sign In for Pricing
View Details
EGF, Human (HEK293, N-hFc)
HY-P72982A-05 100 µg

EGF, Human (HEK293, N-hFc)

Sign In for Pricing
View Details
PIP Antibody
CSB-PA018020LA01HU-01 50 µg

PIP Antibody

Sign In for Pricing
View Details