EGF, Human (HEK293, N-hFc)
The Progranulin/PGRN protein is involved in a variety of cellular processes, including cell growth, inflammation, and neurodegeneration. It acts as a regulator of tissue repair and has been implicated in the pathogenesis of several diseases, including Alzheimer's disease and frontotemporal dementia. Progranulin/PGRN interacts with various receptors and signaling pathways to exert its effects on cellular function and disease progression. EGF Protein, Human (HEK293, N-hFc) is the recombinant human-derived EGF protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
EGF Protein, Human (HEK293, N-hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/egf-protein-human-hek293-n-hfc.html
Purity
98.0
Smiles
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Molecular Formula
1950 (Gene_ID) NP_001954.2 (N971-R1023) (Accession)
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
