Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEP (1-40)

Product Specifications

CAS Number

475221-20-6

Synonyms

H-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2; NH2-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg- Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu- Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-amide

Molecular Formula

C206H324N56O65

Molecular Weight

4,583.08 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VTP50469 mesylate
orb1739634-01 25 mg

VTP50469 mesylate

Sign In for Pricing
View Details
VTP50469 mesylate
orb1739634-02 50 mg

VTP50469 mesylate

Sign In for Pricing
View Details
VTP50469 mesylate
orb1739634-03 100 mg

VTP50469 mesylate

Sign In for Pricing
View Details
PCDHB4 Protein Lysate (Human) with C-Ha Tag
36156031 100 µg

PCDHB4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lentiviral mouse Ppt2 shRNA (UAS) - Lentiviral mousePpt2 shRNA (UAS, GFP) (25)
GTR15221888 1 Vial

Lentiviral mouse Ppt2 shRNA (UAS) - Lentiviral mousePpt2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Beta TRCP (BTRC) (NM_033637) Human Tagged Lenti ORF Clone
RC207025L1 10 µg

Beta TRCP (BTRC) (NM_033637) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details