Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H-MALNSEALSV-OH

Product Specifications

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bradykinin Receptor B1 Antibody
45-338 0.1 mg

Bradykinin Receptor B1 Antibody

Sign In for Pricing
View Details
Human Sphingosine Kinase 1 (SPHK1) ELISA Kit
MBS454091-01 48 Tests

Human Sphingosine Kinase 1 (SPHK1) ELISA Kit

Sign In for Pricing
View Details
Human Sphingosine Kinase 1 (SPHK1) ELISA Kit
MBS454091-02 96 Tests

Human Sphingosine Kinase 1 (SPHK1) ELISA Kit

Sign In for Pricing
View Details
Human Sphingosine Kinase 1 (SPHK1) ELISA Kit
MBS454091-03 5x 96 Tests

Human Sphingosine Kinase 1 (SPHK1) ELISA Kit

Sign In for Pricing
View Details
Human Sphingosine Kinase 1 (SPHK1) ELISA Kit
MBS454091-04 10x 96 Tests

Human Sphingosine Kinase 1 (SPHK1) ELISA Kit

Sign In for Pricing
View Details
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
PH00066-01 1 mg

H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH

Sign In for Pricing
View Details