Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OD1 Toxin

Product Specifications

Synonyms

GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2; H-Gly-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr- Thr-Cys-Ala-Ser-Asn-Gly-Tyr-Cys-Asn-Thr-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Gl u-Ser-Gly-Tyr-Cys-Gln-Trp-Ile-Gly-Arg-Tyr-Gly-Asn-A

Molecular Formula

C308H466N90O95S8

Molecular Weight

7,206.21 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse G Actin Elisa Kit
GTR10420400 96 Well

Mouse G Actin Elisa Kit

Sign In for Pricing
View Details
Fnbp1l (NM_001039609) Rat Tagged Lenti ORF Clone
RR213673L4 10 µg

Fnbp1l (NM_001039609) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BAY-u 9773
HY-107609 25 μg (211.58 μM x 250 μL in Ethanol)

BAY-u 9773

Sign In for Pricing
View Details
ETNK2 (NM_018208) Human Over-expression Lysate
LH10629V 100 µg

ETNK2 (NM_018208) Human Over-expression Lysate

Sign In for Pricing
View Details
KALRN Antibody - middle region (ARP81502_P050)
ARP81502_P050 100 µL

KALRN Antibody - middle region (ARP81502_P050)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) WECF Polyclonal Antibody
MBS7175553 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) WECF Polyclonal Antibody

Sign In for Pricing
View Details