VEGF-C, Mouse/Rat (HEK293, His)
VEGF-C protein stimulates cell proliferation, migration, and vascular permeability, which are critical for angiogenesis and endothelial cell dynamics. It plays a crucial role in the development of the venous and lymphatic vasculature during embryogenesis and in the maintenance of adult lymphatic endothelium. VEGF-C Protein, Mouse/Rat (HEK293, His) is the recombinant mouse, rat-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
VEGF-C Protein, Mouse/Rat (HEK293, His), Mouse; Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vegf-c-protein-mouse-rat-hek293-his.html
Purity
98.0
Smiles
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Molecular Formula
22341/22341/114111 (Gene_ID) P97953-1/NP_033532.1/O35757 (A108-R223) (Accession)
Molecular Weight
Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human Collagen alpha-1(II) chain, COL2A1 ELISA KIT
Mouse BPIFA2 (BPI fold-containing family A member 2) ELISA Kit
Mouse BPIFA2 (BPI fold-containing family A member 2) ELISA Kit