Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL8 Protein

Recombinant Human IL8 Protein is produced by E. coli expression system and the target gene encoding Glu31-Glu90 is expressed with a 6His tag at the C-terminus.

Product Specifications

Structure Composition

ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE

Product Name Alternative

CXCL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor

Reactivity

H

Source

E. coli

Applications

E, WB, SDS-PAGE, MS

Purity

Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE.

Form

Liquid in a 0.2 μm filtered solution of PBS, pH 7.4.

Storage Conditions

Store it at -20°C to -80°C for one year. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

NCBI Gene Symbol

IL8

SwissProt (Human)

P10145

Entrez GeneHuman

3576

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 Polyclonal Antibody
orb1414360 100 µL

CD95 Polyclonal Antibody

Sign In for Pricing
View Details
Migration Inhibitory Factor Related Proteins 8 and 14 (MIF, MRP 8 and 14) (MaxLight 750) discontinued
M3895-08-ML750 100 µL

Migration Inhibitory Factor Related Proteins 8 and 14 (MIF, MRP 8 and 14) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AIMP2 Recombinant Protein (Human)
OPCA04266-100UG 100 µg

AIMP2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Spike Protein (C-His, HCoV-229E)
P521688 100 µg

Spike Protein (C-His, HCoV-229E)

Sign In for Pricing
View Details
Rabbit Polyclonal UBN1 Antibody [Janelia Fluor 549]
NBP1-49983JF549 0.1 mL

Rabbit Polyclonal UBN1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
APRIL Monoclonal Antibody [Sacha-2]
MC-092 100 µg

APRIL Monoclonal Antibody [Sacha-2]

Sign In for Pricing
View Details