Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIMP2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Aminoacyl tRNA synthetase complex interacting multifunctional protein 2

Gene Aliases

Aminoacyl tRNA synthase complex-interacting multifunctional protein 2; ARS-interacting multi-functional protein 2; HLD17; JTV1; JTV-1; multisynthase complex auxiliary component p38; multisynthetase complex auxiliary component p38; P38; protein JTV-1.

Gene ID

7965

Accession Number

NP_006294

Reactivity

Homo sapiens|Human

Target

Required for assembly and stability of the aminoacyl-tRNA synthase complex (PubMed:19131329) . Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.

Type

Protein

Source

E.coli

Sequence

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AIMP2

Protein Name

Aminoacyl tRNA synthase complex-interacting multifunctional protein 2

Gene Name URL

AIMP2

Nucleotide Accession Number

NM_006303

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF-21 ELISA Kit
EK1151-01 48 Tests

Human FGF-21 ELISA Kit

Sign In for Pricing
View Details
Human FGF-21 ELISA Kit
EK1151-02 96 Tests

Human FGF-21 ELISA Kit

Sign In for Pricing
View Details
Ranbp1 AAV siRNA Pooled Vector
38473164 1.0 µg

Ranbp1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Id1 Recombinant Antibody
RAC07052-01 50 µL

Id1 Recombinant Antibody

Sign In for Pricing
View Details
Id1 Recombinant Antibody
RAC07052-02 100 µL

Id1 Recombinant Antibody

Sign In for Pricing
View Details
Human Iduronate-2-Sulfatase (IDS) Antibody Pair Kit (with Standard)
MBS2103928-01 5x 96 Tests

Human Iduronate-2-Sulfatase (IDS) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details