Question 1

What is the catalog number for SMYD3 Rabbit mAb?

Accepted Answer

The catalog number for SMYD3 Rabbit mAb is C06236.

Question 2

What sizes are available for SMYD3 Rabbit mAb?

Accepted Answer

SMYD3 Rabbit mAb is available in the following size(s): 20 µL, 100 µL, 2x 100 μL.

Question 3

How many pack sizes does SMYD3 Rabbit mAb come in?

Accepted Answer

SMYD3 Rabbit mAb is available in 3 different pack sizes.

Question 4

Is SMYD3 Rabbit mAb in stock?

Accepted Answer

SMYD3 Rabbit mAb is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is the purity of this recombinant protein?

Accepted Answer

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

Question 6

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Accepted Answer

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

Question 7

What host species was used to raise this antibody?

Accepted Answer

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

SMYD3 Rabbit mAb

Product Specifications

SKU

Target

Applications

Storage Conditions

Available Sizes

Frequently Asked Questions

Explore Other Products

TUBB2C, ID (TUBB4B, TUBB2C, Tubulin beta-4B chain, Tubulin beta-2 chain, Tubulin beta-2C chain) (MaxLight 405) discontinued

HSD17B6 3'UTR Luciferase Stable Cell Line

[Des-Leu9]-Kinetensin

[Des-Leu9]-Kinetensin

[Des-Leu9]-Kinetensin

H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH