Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Rat

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Rat is produced in E. coli , and consists of 62 amino acids (I46-I107) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-rat.html

Purity

95.0

Smiles

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Molecular Formula

246358 (Gene_ID) Q99ME0 (I46-I107) (Accession)

Molecular Weight

Approximately 10.03 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Oda M, et al. Thrombopoietin-induced CXC chemokines, NAP-2 and PF4, suppress polyploidization and proplatelet formation during megakaryocyte maturation. Genes Cells. 2003 Jan;8 (1) :9-15.|[2]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[3]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMPR1B (NM_001203) Human Over-expression Lysate
LC420076 20 µg

BMPR1B (NM_001203) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-eIF4E (S209) Recombinant Rabbit Monoclonal Antibody [SU0396]
ET1608-66 100 µL

Phospho-eIF4E (S209) Recombinant Rabbit Monoclonal Antibody [SU0396]

Sign In for Pricing
View Details
Recombinant Human GM-CSF
6585 5 µg

Recombinant Human GM-CSF

Sign In for Pricing
View Details
SLC34A3 (NM_001177316) Human Over-expression Lysate
LY433328 100 µg

SLC34A3 (NM_001177316) Human Over-expression Lysate

Sign In for Pricing
View Details
RAB5B Polyclonal Antibody
E-AB-40198-01 25 µL

RAB5B Polyclonal Antibody

Sign In for Pricing
View Details
RAB5B Polyclonal Antibody
E-AB-40198-02 100 µL

RAB5B Polyclonal Antibody

Sign In for Pricing
View Details