Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxd3 3'UTR Luciferase Stable Cell Line

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp982 (NM_001039209) Mouse Tagged Lenti ORF Clone
MR205664L4 10 µg

Zfp982 (NM_001039209) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Upf3a 3'UTR Lenti-reporter-Luc Vector
49208086 1.0 µg

Upf3a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HHV4/CMV Rabbit pAb
E47R0866 100 µL

HHV4/CMV Rabbit pAb

Sign In for Pricing
View Details
GNAI3 Antibody
E51A06644 100 µL

GNAI3 Antibody

Sign In for Pricing
View Details
PRR11 Mouse Monoclonal Antibody [Clone ID: LBI1C1]
AMM14663V 100 µL

PRR11 Mouse Monoclonal Antibody [Clone ID: LBI1C1]

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details