Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28, Rat (HEK293, His)

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity) . CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD28 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd28-protein-rat-hek293-his.html

Purity

95.00

Smiles

NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPK

Molecular Formula

25660 (Gene_ID) P31042 (N20-K149) (Accession)

Molecular Weight

The protein migrates as approximately 30-36 kDa under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'- (((12,13-Bis (2-ethylhexyl) -3,9-diundecyl-12,13-dihydro-[1,2,5]thiadiazolo[3,4-e]thieno[2'',3'':4',5']thieno[2',3':4,5]pyrrolo[3,2-g]thieno[2',3':4,5]thieno[3,2-b]indole-2,10-diyl) bis (methaneylylidene) ) bis (5,6-difluoro-3-oxo-2,3-dihydro-1H-indene-2,1-diylidene) ) dimalononitrile
JH916050 1 Each

2,2'- (((12,13-Bis (2-ethylhexyl) -3,9-diundecyl-12,13-dihydro-[1,2,5]thiadiazolo[3,4-e]thieno[2'',3'':4',5']thieno[2',3':4,5]pyrrolo[3,2-g]thieno[2',3':4,5]thieno[3,2-b]indole-2,10-diyl) bis (methaneylylidene) ) bis (5,6-difluoro-3-oxo-2,3-dihydro-1H-indene-2,1-diylidene) ) dimalononitrile

Sign In for Pricing
View Details
Ned 19
orb1309345-01 1 mg

Ned 19

Sign In for Pricing
View Details
Ned 19
orb1309345-02 2 mg

Ned 19

Sign In for Pricing
View Details
Ned 19
orb1309345-03 5 mg

Ned 19

Sign In for Pricing
View Details
Ned 19
orb1309345-04 1 ml x 10 mM (in DMSO)

Ned 19

Sign In for Pricing
View Details
Ned 19
orb1309345-05 10 mg

Ned 19

Sign In for Pricing
View Details