Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (154a.a, His)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (154a.a, His), consists of 154 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (154a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-154a-a-his.html

Purity

98.00

Smiles

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (A135-S288) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Membrane Protein, Palmitoylated 2 (MPP2) Polyclonal Antibody
CAU27387-01 100 µL

Membrane Protein, Palmitoylated 2 (MPP2) Polyclonal Antibody

Sign In for Pricing
View Details
Membrane Protein, Palmitoylated 2 (MPP2) Polyclonal Antibody
CAU27387-02 200 µL

Membrane Protein, Palmitoylated 2 (MPP2) Polyclonal Antibody

Sign In for Pricing
View Details
Membrane Protein, Palmitoylated 2 (MPP2) Polyclonal Antibody
CAU27387-03 1 mL

Membrane Protein, Palmitoylated 2 (MPP2) Polyclonal Antibody

Sign In for Pricing
View Details
Glycogen synthase (phospho Ser9) Antibody
50-228 0.1 mL

Glycogen synthase (phospho Ser9) Antibody

Sign In for Pricing
View Details
DRP1 (C-5) Alexa Fluor® 488
sc-271583 AF488 200 µg/mL

DRP1 (C-5) Alexa Fluor® 488

Sign In for Pricing
View Details
PPIA CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
37320154 3x 1.0 µg DNA

PPIA CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details