Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSME3, Human (N-His)

PSME3 is a subunit of the 11S REG-gamma proteasome modulator that forms a homoheptamer and is essential for activating the trypsin-like subunit of the proteasome and inhibiting the chymotrypsin-like and PGPH subunits. PSME3 promotes MDM2-p53 interaction, leading to p53 degradation and inhibiting apoptosis after DNA damage. PSME3 Protein, Human (N-His) is the recombinant human-derived PSME3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PSME3 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psme3-protein-human-n-his.html

Purity

96.00

Smiles

MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Molecular Formula

10197 (Gene_ID) P61289 (M1-Y254) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin D (F-3) AC
sc-398553 AC 500 µg/mL - 25% ag

Cystatin D (F-3) AC

Sign In for Pricing
View Details
POP4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV676701 1.0 µg DNA

POP4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
APOOL polyclonal antibody
BS61568-01 50 µL

APOOL polyclonal antibody

Sign In for Pricing
View Details
APOOL polyclonal antibody
BS61568-02 100 µL

APOOL polyclonal antibody

Sign In for Pricing
View Details
PIK3IP1, CT (PIK3IP1, HGFL, Phosphoinositide-3-kinase-interacting protein 1, Kringle domain-containing protein HGFL) (MaxLight 550) discontinued
040044-ML550 100 µL

PIK3IP1, CT (PIK3IP1, HGFL, Phosphoinositide-3-kinase-interacting protein 1, Kringle domain-containing protein HGFL) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Osteopontin Rabbit Polyclonal Antibody (PE-Cy7)
orb914137 100 µL

Osteopontin Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details