Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse DNAX Accessory Molecule-1/DNAM-1/CD226 (C-6His)

Source: Human Cells. MW :27.6kD. Recombinant Mouse DNAX Accessory Molecule-1 is produced by our Mammalian expression system and the target gene encoding Glu19-Pro254 is expressed fused with a 6His tag at the C-terminus. Mouse DNAX accessory molecule-1 (DNAM-1) is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily. As an activating receptor, it interacts with the ligands CD155 and CD112, and activates natural killer (NK) cells via its immu-noreceptor tyrosine-based activatory motif (ITAM) . Mature mouse DNAM-1 has extracellular domain (ECD) that contains two Ig-like C2-set domains, and possesses a cytoplasmic region that contains motifs for binding PDZ domains. DNAM-1 is expressed on several lymphoid and myeloid cell types and interacts with CD155/PVR and Nectin-2/CD112. Ligation of DNAM-1 promotes the activation of NK cells, CD8+ T cells, and mast cells, induces dendritic cell maturation, initiates megakaryocyte and activated platelet adhesion to vascular endothelial cells, and stimulates monocyte extravasation; Conversely, it inhibits the formation of osteoclasts. Platelet-endothelium interactions that are mediated by DNAM-1 enable the metastasis of tumor cells to the lung.

Product Specifications

Gene Name

Cd226

Gene ID

225825

UniProt

Q8K4F0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goose 8-Oxoguanine DNA Glycosylase (OGG) ELISA Kit
MBS9904846 Inquire

Goose 8-Oxoguanine DNA Glycosylase (OGG) ELISA Kit

Ask
View Details
(S) - (-) -N- (3-Pentyl) -1-phenylethylamine hydrochloride
sc-272317 1 g

(S) - (-) -N- (3-Pentyl) -1-phenylethylamine hydrochloride

Ask
View Details
Canine Lymphatic Fibroblasts
ABC-TC080D 1 Vial

Canine Lymphatic Fibroblasts

Ask
View Details
Lsm10 Rat shRNA Plasmid (Locus ID 366468)
TL707498 1 Kit

Lsm10 Rat shRNA Plasmid (Locus ID 366468)

Ask
View Details
QuicKey Pro Human TG (Thyroglobulin) ELISA Kit
E-OSEL-H0075-01 24 Tests

QuicKey Pro Human TG (Thyroglobulin) ELISA Kit

Ask
View Details
QuicKey Pro Human TG (Thyroglobulin) ELISA Kit
E-OSEL-H0075-02 48 Tests

QuicKey Pro Human TG (Thyroglobulin) ELISA Kit

Ask
View Details