Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL-1 Receptor Type 1/IL-1R-1 (C-Fc)

Source: Human cells. MW :62.9kD. Recombinant Human Interleukin-1 receptor type 1/IL-1R-1 is produced by our Mammalian expression system and the target gene encoding Leu18-Thr332 is expressed fused with a Fc tag at the C-terminus. Interleukin 1 receptor, type I (IL-1R1) is an interleukin receptor that belongs to the interleukin-1 receptor family. IL-1R1 is an 80 kDa transmembrane protein that is expressed predominantly by T cells, fibroblasts, and endothelial cells. This gene along with IL1R2, IL1RL2, and IL1RL1 form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. IL-1R1 is an important mediator involved in many cytokine induced immune and inflammatory responses. It binds to interleukin-1 associates with the corecptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. The signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. It also binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor in the presence of IL1a or IL1 beta but not IL1ra, was identified. Recombinant IL1 soluble receptor Type I is a potent antagonist of IL1 action.

Product Specifications

Gene Name

IL1R1

Gene ID

3554

UniProt

P14778

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Peroxiredoxin 6 MAb (Clone 477068R)
MAB3490R-SP 25 µg

Human Peroxiredoxin 6 MAb (Clone 477068R)

Ask
View Details
PI 3 Kinase catalytic subunit gamma (PIK3CG) (NM_002649) Human 3' UTR Clone
SC216338 10 µg

PI 3 Kinase catalytic subunit gamma (PIK3CG) (NM_002649) Human 3' UTR Clone

Ask
View Details
Recombinant Vanin 1 (VNN1)
MBS2010385-01 0.01 mg

Recombinant Vanin 1 (VNN1)

Ask
View Details
Recombinant Vanin 1 (VNN1)
MBS2010385-02 0.05 mg

Recombinant Vanin 1 (VNN1)

Ask
View Details
Recombinant Vanin 1 (VNN1)
MBS2010385-03 0.1 mg

Recombinant Vanin 1 (VNN1)

Ask
View Details
Recombinant Vanin 1 (VNN1)
MBS2010385-04 0.2 mg

Recombinant Vanin 1 (VNN1)

Ask
View Details