Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human KIR2DL3/NKAT2/CD158b2 (C-6His)

Source: Human Cells. MW :25.4kD. Recombinant Human KIR2DL3 is produced by our Mammalian expression system and the target gene encoding His22-His245 is expressed with a 6His tag at the C-terminus. Killer-Cell Immunoglobulin-Like Receptors (KIRs) are important cells of the immune system. KIRs are a family of Natural Killer (NK) Cells surface glycoproteins. KIRs control the killing function of these cells by interacting with MHC class I molecules. This interaction allows KIRs to identify virally infected cells or tumor cells by the distinctive low level of Class I MHC on their surface. The majority of KIRs are inhibitory, their recognition of MHC suppresses the cytotoxic activity of their NK cell. Only a limited number of KIRs have the capacity to activate cells. KIR2DL3 is an inhibitory Killer Cell Ig-like Receptor. KIR2DL3 recognizes class I MHC molecules (HLA-Cw1, -Cw3, -Cw7, and Cw8) . KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.

Product Specifications

Gene Name

KIR2DL3

Gene ID

3804

UniProt

P43628

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Frozen Tissue Sections, Colon
CS612629 5x 5 µm

Frozen Tissue Sections, Colon

Ask
View Details
Rabbit IgG Antibody
GWB-7B71B1 1 mL

Rabbit IgG Antibody

Ask
View Details
CD99 Antibody / MIC2
V5354-20UG 20 µg

CD99 Antibody / MIC2

Ask
View Details
Myo-Inositol hexasulfate hexapotassium salt
sc-215406A 250 mg

Myo-Inositol hexasulfate hexapotassium salt

Ask
View Details
Glucocorticoid Receptor (GCR) (Biotin)
MBS6248972-01 0.1 mL

Glucocorticoid Receptor (GCR) (Biotin)

Ask
View Details
Glucocorticoid Receptor (GCR) (Biotin)
MBS6248972-02 5x 0.1 mL

Glucocorticoid Receptor (GCR) (Biotin)

Ask
View Details