Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OX40/TNFRSF4/CD134 (C-6His)

Source: Human Cells. MW :21kD. Recombinant Human OX40 is produced by our Mammalian expression system and the target gene encoding Leu29-Ala216 is expressed with a 6His tag at the C-terminus. OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

Product Specifications

Gene Name

TNFRSF4

Gene ID

7293

UniProt

P43489

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Polygalacin D3
HY-N13164-01 1 mg

Polygalacin D3

Ask
View Details
Polygalacin D3
HY-N13164-02 5 mg

Polygalacin D3

Ask
View Details
RPL27AP5 ORF Vector (Human) (pORF)
41275011 1.0 µg DNA

RPL27AP5 ORF Vector (Human) (pORF)

Ask
View Details
Furacilin Metabolite ELISA Kit
ZKH0068 96 Tests

Furacilin Metabolite ELISA Kit

Ask
View Details
Recombinant Human STX6 Protein, C-His
YHA77001 100 μg

Recombinant Human STX6 Protein, C-His

Ask
View Details
Rat Monoclonal PLZF Antibody (816421) [Alexa Fluor 532]
FAB29441X 0.1 mL

Rat Monoclonal PLZF Antibody (816421) [Alexa Fluor 532]

Ask
View Details