Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-21/IL-21

Source: E.coli. MW :14.4kD. Recombinant Mouse Interleukin-21 is produced by our E.coli expression system and the target gene encoding Pro25-Ser146 is expressed. Interleukin-21 also known as IL-21 is a protein that in mouse is encoded by the IL21 gene, belongs to the IL-15/IL-21 family. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.

Product Specifications

Gene Name

Il21

Gene ID

60505

UniProt

Q9ES17

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CTDSP1-V250 Antibody (C-term) [APR15619G]
APR15619G-01 50 µL

CTDSP1-V250 Antibody (C-term) [APR15619G]

Ask
View Details
CTDSP1-V250 Antibody (C-term) [APR15619G]
APR15619G-02 100 µL

CTDSP1-V250 Antibody (C-term) [APR15619G]

Ask
View Details
CTDSP1-V250 Antibody (C-term) [APR15619G]
APR15619G-03 200 µL

CTDSP1-V250 Antibody (C-term) [APR15619G]

Ask
View Details
CTDSP1-V250 Antibody (C-term) [APR15619G]
APR15619G-04 400 µL

CTDSP1-V250 Antibody (C-term) [APR15619G]

Ask
View Details
Rabbit Polyclonal CASZ1 Antibody [Alexa Fluor 532]
NBP3-06281AF532 0.1 mL

Rabbit Polyclonal CASZ1 Antibody [Alexa Fluor 532]

Ask
View Details
ROR2 (NM_004560) Human Mutant ORF Clone
RC402757 10 µg

ROR2 (NM_004560) Human Mutant ORF Clone

Ask
View Details