Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-D2/CCND2 (N-6His)

Source: E.coli. MW :35.36kD. Recombinant Human Cyclin-D2 is produced by our E.coli expression system and the target gene encoding Met1-Leu289 is expressed with a 6His tag at the N-terminus. CCND2, also known as G1/S-specific cyclin-D2, is a member of the highly conserved cyclin family. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Cyclins function as regulators of CDK kinases. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. CCND2 is involved in a number of fundamental biological processes such as phosphorylating and inhibiting members of the retinoblastoma (RB) protein family including RB1 and regulating the cell-cycle during G1/S transition. It is also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G1 phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.

Product Specifications

Gene Name

CCND2

Gene ID

894

UniProt

P30279

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,5mM DTT, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMMELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human ATG2A activation kit by CRISPRa
GA108059 1 Kit

Human ATG2A activation kit by CRISPRa

Ask
View Details
Cytokeratin 18 discontinued
381183 200 µL

Cytokeratin 18 discontinued

Ask
View Details
Nrf2-Activator-12G
HY-115849-01 5 mg

Nrf2-Activator-12G

Ask
View Details
Nrf2-Activator-12G
HY-115849-02 10 mg

Nrf2-Activator-12G

Ask
View Details
Hal Mouse qPCR Primer Pair (NM_010401)
MP206121 200 Reactions

Hal Mouse qPCR Primer Pair (NM_010401)

Ask
View Details