Recombinant Human Macrophage Migration Inhibitory Factor/MIF
Source: E. coli. MW :12.5kD. Recombinant Human Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Met1-Ala115 is expressed. Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without asignal sequence .Secretion occurs nonclassically via an ABCA1 transporter.Pro-inflammatory cytokine.Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites ofinflammation suggests a role as mediator in regulating the function of acrophages in host defense.Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase anddopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clearwhether the tautomerase activity has any physiological relevance, and whether it is important for cytokineactivity.
Product Specifications
Gene Name
MIF
Gene ID
4282
UniProt
P14174
Components
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
