Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage Migration Inhibitory Factor/MIF

Source: E. coli. MW :12.5kD. Recombinant Human Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Met1-Ala115 is expressed. Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without asignal sequence .Secretion occurs nonclassically via an ABCA1 transporter.Pro-inflammatory cytokine.Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites ofinflammation suggests a role as mediator in regulating the function of acrophages in host defense.Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase anddopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clearwhether the tautomerase activity has any physiological relevance, and whether it is important for cytokineactivity.

Product Specifications

Gene Name

MIF

Gene ID

4282

UniProt

P14174

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nlrp14 (NM_001002894) Mouse Untagged Clone
MC223002 10 µg

Nlrp14 (NM_001002894) Mouse Untagged Clone

Ask
View Details
Murashige and Skoog (MS) Medium Plates, w/ Hygromycin
30630060-2 50 Plate(s)

Murashige and Skoog (MS) Medium Plates, w/ Hygromycin

Ask
View Details
TFPI2 Protein (N-His, Human)
P508991 100 µg

TFPI2 Protein (N-His, Human)

Ask
View Details