Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Migration Inhibitory Factor/MIF (C-6His)

Source: E. coli. MW :13.5kD. Recombinant Mouse Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Pro2-Ala115 is expressed with a 6His tag at the C-terminus. Macrophage migration inhibitory factor (MIF) is a secreted protein and belongs to the MIF family. MIF is an important regulator of innate immunity. The circulating MIF binds to CD74 on other immune cells to trigger an acute immune response. Hence MIF is classified as an inflammatory cytokine. Furthermore glucocorticoids also stimulate white blood cells to release MIF and hence MIF partially counter acts the inhibitory effects that glucocorticoids have on the immune system. Finally trauma activates the anterior pituitary gland to release MIF.

Product Specifications

Gene Name

Mif

Gene ID

17319

UniProt

P34884

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFALEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LIMS3 Antibody
NBP3-09748-100ul 100 µL

Rabbit Polyclonal LIMS3 Antibody

Sign In for Pricing
View Details
PD-1:PD-L2[Biotinylated] Inhibitor Screening Colorimetric Assay Kit
72017 96 Reactions

PD-1:PD-L2[Biotinylated] Inhibitor Screening Colorimetric Assay Kit

Sign In for Pricing
View Details
SecinH3
C18020 100 mg

SecinH3

Sign In for Pricing
View Details
Recombinant Mouse KSR1 Protein, His (Fc)-Avi-tagged
KSR1-4966M 50 µg

Recombinant Mouse KSR1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CERCAM Antibody
CSB-PA005255GA01HU 100 µL

CERCAM Antibody

Sign In for Pricing
View Details
Rat rno-miR-3572 miRNA Antagomir
abx890361-01 10 nmol

Rat rno-miR-3572 miRNA Antagomir

Sign In for Pricing
View Details