Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 19/FGF-19 (N-6His)

Source: E. coli. MW :23.5kD. Recombinant Human Fibroblast growth factor 19 is produced by our E.coli expression system and the target gene encoding Phe27-Lys216 is expressed with a 6His tag at the N-terminus. Fibroblast growth factor 19 (FGF19) is a secreted protein which belongs to the FGFs family. FGF19 is expressed in fetal brain, cartilage, retina, and adult gall bladder. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs) : FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity. FGFRs can be important for regulation of glucose and lipid homeostasis. FGF19 has important roles as a hormone produced in the ileum in response to bile acid absorption. It has been shown to cause resistance to diet-induced obesity and insulin desensitization and to improve insulin, glucose, and lipid profiles in diabetic rodents. FGF19 can be considered as a regulator of energy expenditure.

Product Specifications

Gene Name

FGF19

Gene ID

9965

UniProt

O95750

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Polyclonal Goat anti-Canine IgG1 Heavy Chain Secondary Antibody [DyLight 350]
NB7328UV 1 mL

Goat Polyclonal Goat anti-Canine IgG1 Heavy Chain Secondary Antibody [DyLight 350]

Ask
View Details
Ruxolitinib (S enantiomer)
HY-50856A-01 5 mg

Ruxolitinib (S enantiomer)

Ask
View Details
Ruxolitinib (S enantiomer)
HY-50856A-02 10 mM - 1 mL

Ruxolitinib (S enantiomer)

Ask
View Details
Ruxolitinib (S enantiomer)
HY-50856A-03 10 mg

Ruxolitinib (S enantiomer)

Ask
View Details
Ruxolitinib (S enantiomer)
HY-50856A-04 50 mg

Ruxolitinib (S enantiomer)

Ask
View Details
Ruxolitinib (S enantiomer)
HY-50856A-05 100 mg

Ruxolitinib (S enantiomer)

Ask
View Details