Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 4A1/SULT4A1

Source: E. coli. MW :33kD. Recombinant Human Sulfotransferase 4A1 is produced by our E.coli expression system and the target gene encoding Met1-Leu284 is expressed. Sulfotransferase 4A1 (ST4A1) is a member of the Sulfotransferase 1 family. ST4A1 is highly expressed in the cerebral cortex and frontal lobe, but no expression is detected in the pancreas. ST4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. ST4A1 acts on catecholamines and T4 in a manner that may not involve sulfonation. ST4A1 may have a role in the metabolism of drugs and neurotransmitters in the CNS. In addition, ST4A1 is related to schizophrenia.

Product Specifications

Gene Name

SULT4A1

Gene ID

25830

UniProt

Q9BR01

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal REEP1 Antibody
NBP3-14647-50ul 50 µL

Rabbit Polyclonal REEP1 Antibody

Ask
View Details
Mouse Monoclonal MZF1 Antibody (PCRP-MZF1-1E8) [DyLight 650]
NBP3-24013C 0.1 mL

Mouse Monoclonal MZF1 Antibody (PCRP-MZF1-1E8) [DyLight 650]

Ask
View Details
DPY19L4 (NM_181787) Human Tagged Lenti ORF Clone
RC211095L4 10 µg

DPY19L4 (NM_181787) Human Tagged Lenti ORF Clone

Ask
View Details
APC anti-human CD82
GT11671 100 Tests

APC anti-human CD82

Ask
View Details
TNFRSF4 (NM_003327) Human Tagged Lenti ORF Clone
RC211253L2 10 µg

TNFRSF4 (NM_003327) Human Tagged Lenti ORF Clone

Ask
View Details
Anti-TLR4 Antibody
F44373-0.4ML 0.4 mL

Anti-TLR4 Antibody

Ask
View Details