Recombinant Human Interleukin-3/IL-3 (N-6His)
Source: E. coli. MW :16.6kD. Recombinant Human Interleukin-3 is produced by our E.coli expression system and the target gene encoding Ala20-Phe152 is expressed with a 6His tag at the N-terminus. Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders.
Product Specifications
Gene Name
IL3
Gene ID
3562
UniProt
P08700
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MNHKVHHHHHHMAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items