Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA Fragmentation Factor Subunit a/DFFA/DFF45/ICAD (N-6His)

Source: E. coli. MW :38.7kD. Recombinant Human DFF45 is produced by our E.coli expression system and the target gene encoding Met1-Thr331 is expressed with a 6His tag at the N-terminus. DNA Fragmentation Factor Subunit Alpha (DFFA) . DFFA exists as a heterodimer (DFF) with DFFB. DFF is activated once DFFA is cleaved by Caspase-3. The cleaved fragments of DFFA detach from DFFB (the active component of DFF), which in turn triggers DNA fragmentation as well as chromatin condensation during apoptosis. A reduced level of DFFA detected in ovarian endometriosis may be a part of an apoptosis-resistant mechanism enhancing the disease progression.

Product Specifications

Gene Name

DFFA

Gene ID

1676

UniProt

O00273

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Microfibrillar-associated Protein 5 (Biotin)
323854-01 50 µg

Microfibrillar-associated Protein 5 (Biotin)

Ask
View Details
Microfibrillar-associated Protein 5 (Biotin)
323854-02 100 µg

Microfibrillar-associated Protein 5 (Biotin)

Ask
View Details
TPSAB1 Antibody
ABD6758 100 µg

TPSAB1 Antibody

Ask
View Details
Norfenfluramine
HY-118010 1 Each

Norfenfluramine

Ask
View Details
Recombinant Escherichia coli O6 Quaternary ammonium compound-resistance protein sugE (sugE), partial
MBS7093671 Inquire

Recombinant Escherichia coli O6 Quaternary ammonium compound-resistance protein sugE (sugE), partial

Ask
View Details