Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His)

Source: Human Cells. MW :9.95kD. Recombinant Human C-C Motif Chemokine 8 is produced by our Mammalian expression system and the target gene encoding Gln24-Pro99 is expressed with a 6His tag at the C-terminus. Human Chemokine (C-C Motif) Ligand 8 (CCL8) is produced by human MG63 osteosarcoma cells. CCL8 shares 62% and 58% amino acid sequence identity with MCP-1 and MCP-3, respectively. All three MCP proteins are monocyte chemoattractants. CCL8 is chemotactic for and activates many different immune cells, including mast cells, eosinophils and basophils, which are implicated in allergic response, and monocytes, T cells, and NK cells that are involved in the inflammatory response. CCL8 elicits its effects by binding to several different cell surface receptors including CCR1, CCR2B and CCR5.

Product Specifications

Gene Name

CCL8

Gene ID

6355

UniProt

P80075

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKPVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF207 (NM_003457) Human Tagged Lenti ORF Clone
RC223933L2 10 µg

ZNF207 (NM_003457) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MYO7A Antibody, HRP conjugated
A55629-50UG 50 µg

MYO7A Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse SCF Protein
PRP1104-01 1 mg

Mouse SCF Protein

Sign In for Pricing
View Details
Mouse SCF Protein
PRP1104-02 5 µg

Mouse SCF Protein

Sign In for Pricing
View Details
Mouse SCF Protein
PRP1104-03 20 µg

Mouse SCF Protein

Sign In for Pricing
View Details
Mouse SCF Protein
PRP1104-04 100 µg

Mouse SCF Protein

Sign In for Pricing
View Details