Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lysozyme G-Like Protein 2/LYG2 (C-6His)

Source: Human Cells. MW :22.55kD. Recombinant Human Lysozyme G-Like Protein 2 is produced by our Mammalian expression system and the target gene encoding Ser20-Phe212 is expressed with a 6His tag at the C-terminus. Lysozyme G-Like Protein 2 (LYG2) is a secreted protein that belongs to the glycosyl hydrolase 23 family. LYG2 contains one SLT domain, one protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL) . SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc) . LYG2 has hydrolase activity which acting on glycosyl bonds, and possess lysozyme activity.

Product Specifications

Gene Name

LYG2

Gene ID

254773

UniProt

Q86SG7

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,10%Glycerol, pH7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSFVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MIA2, Recombinant, Human (Melanoma Inhibitory Activity Protein 2, FLJ22404) discontinued
143433-01 5 µg

MIA2, Recombinant, Human (Melanoma Inhibitory Activity Protein 2, FLJ22404) discontinued

Ask
View Details
MIA2, Recombinant, Human (Melanoma Inhibitory Activity Protein 2, FLJ22404) discontinued
143433-02 20 µg

MIA2, Recombinant, Human (Melanoma Inhibitory Activity Protein 2, FLJ22404) discontinued

Ask
View Details
Ado Mouse Pre-designed siRNA Set A
HY-RS18889 1 Set

Ado Mouse Pre-designed siRNA Set A

Ask
View Details
Mouse Monoclonal Mesothelin Antibody (rMSLN/8764) [Alexa Fluor 488]
NBP3-20892AF488 0.1 mL

Mouse Monoclonal Mesothelin Antibody (rMSLN/8764) [Alexa Fluor 488]

Ask
View Details
Acetyl-DNMT1-K1127/K1129/K1131/K1133 polyclonal antibody
BS7948-01 50 µL

Acetyl-DNMT1-K1127/K1129/K1131/K1133 polyclonal antibody

Ask
View Details
Acetyl-DNMT1-K1127/K1129/K1131/K1133 polyclonal antibody
BS7948-02 100 µL

Acetyl-DNMT1-K1127/K1129/K1131/K1133 polyclonal antibody

Ask
View Details