Recombinant Human Ribose-Phosphate Pyrophosphokinase 2/PRPS2 (C-6His)

Source: Human Cells. MW :35.8kD. Recombinant Human PRPS2 is produced by our Mammalian expression system and the target gene encoding Pro2-Leu318 is expressed with a 6His tag at the C-terminus. Ribose-Phosphate Pyrophosphokinase 2 (PRPS2) is a phosphoribosyl pyrophosphate synthetase that belongs to the ribose-phosphate pyrophosphokinase family. PRPS2 is a homodimer. The active form is probably an hexamer composed of three homodimers. PRPS2 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. PRPS2 catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. In addition, PRPS2 plays a central role in the synthesis of purines and pyrimidines.

Product Specifications

Gene Name

PRPS2

Gene ID

5634

UniProt

P11908

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLVDHHHHHH