Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon Lambda-1/IL-29/IFN-Lambda1 (C-10His)

Source: Human Cells. MW :21.4kD. Recombinant Human Interferon Lambda-1 is produced by our Mammalian expression system and the target gene encoding Gly20-Thr200 is expressed with a 6His at the C-terminus. Interleukin-29 (IL-29) is a secreted protein which belongs to the IL-28/IL-29 family. IL-29 is a cytokine with immunomodulatory activity. IL-29 is highly similar in amino acid sequence to the IL-28. IL-28 and IL-29 are induced by viral infection and showed antiviral activity. IL-28 and IL-29 interacted with a heterodimeric class II cytokine receptor that consisted of IL-10 receptor beta (IL-10R beta) and an orphan class II receptor chain, designated IL-28R alpha. IL-29 plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. IL-29 may play a role in antiviral immunity. IL-29 up-regulates MHC class I antigen expression. It is a Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Product Specifications

Gene Name

IFNL1

Gene ID

282618

UniProt

Q8IU54

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD1 discontinued
345369-01 100 µL

PKD1 discontinued

Sign In for Pricing
View Details
PKD1 discontinued
345369-02 200 µL

PKD1 discontinued

Sign In for Pricing
View Details
CD1E Human Over-expression Lysate
orb1343930 100 µg

CD1E Human Over-expression Lysate

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Canine IgG (H+L) Secondary Antibody [Janelia Fluor 646]
NBP2-60652JF646 0.5 mL

Goat Polyclonal Goat anti-Canine IgG (H+L) Secondary Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Phosphate Buffer, 10X
AR-6565-02 100 mL

Phosphate Buffer, 10X

Sign In for Pricing
View Details
MYL12B Recombinant Antibody, Biotin Conjugated
bsm-62539R-Biotin-01 20 µL

MYL12B Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details