Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poliovirus Receptor/PVR/CD155 (C-6His)

Source: Human Cells. MW :36.13kD. Recombinant Human 0 is produced by our Mammalian expression system and the target gene encoding Trp21-Asn343 is expressed with a 6His tag at the C-terminus. Poliovirus Receptor (PVR) is a 70 kDa type I transmembrane single-span glycoprotein that belongs to the nectin-like (Necl) family and was originally identified based on its ability to mediate the cell attachment and entry of poliovirus (PV), an etiologic agent of the central nervous system disease poliomyelitis. PVR contains three Ig-like extracellular domains, a transmembrane segment, and a cytoplasmic tail. The normal cellular function of PVR maybe the involvement of intercellular adhension between epithelial cells. Alternate splicing of the PVR mRNA yields four different isoforms (a, beta, gamma, and d) with identical extracellular domains.

Product Specifications

Gene Name

PVR

Gene ID

5817

UniProt

P15151

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Oxidosqualene Cyclase ELISA Kit
MBS006327-01 48 Well

Rat Oxidosqualene Cyclase ELISA Kit

Ask
View Details
Rat Oxidosqualene Cyclase ELISA Kit
MBS006327-02 96 Well

Rat Oxidosqualene Cyclase ELISA Kit

Ask
View Details
Rat Oxidosqualene Cyclase ELISA Kit
MBS006327-03 5x 96 Well

Rat Oxidosqualene Cyclase ELISA Kit

Ask
View Details
Rat Oxidosqualene Cyclase ELISA Kit
MBS006327-04 10x 96 Well

Rat Oxidosqualene Cyclase ELISA Kit

Ask
View Details
APC Anti-Mouse CD163 Antibody[S15049F]
RD30668F-01 50 Tests

APC Anti-Mouse CD163 Antibody[S15049F]

Ask
View Details
APC Anti-Mouse CD163 Antibody[S15049F]
RD30668F-02 100 Tests

APC Anti-Mouse CD163 Antibody[S15049F]

Ask
View Details