Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfatase Modifying Factor 1/SUMF1 (C-6His)

Source: Human Cells. MW :38.27kD. Recombinant Human SUMF1 is produced by our Mammalian expression system and the target gene encoding Ser34-Asp374 is expressed with a 6His tag at the C-terminus. Human Sulfatase Modifying Factor 1 (SUMF1) is a 42kDa protein. SUMF1 is a Ca2+-binging member of the sulfatase-modifying factor family. SUMF1 is a soluble ER lumenal glycoprotein, it converts inactive sulfatases into an active form by transforming a catalytic site cysteine into a formylglycine residue. In the ER, SUMF1 can exist as either a monomer, or a disulfide-linked homodimer or a heterodimer with SUMF2. Three splice isoforms are known.

Product Specifications

Gene Name

SUMF1

Gene ID

285362

UniProt

Q8NBK3

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNI3 (Ab-43) Antibody
8B0816-AAT 50 µg

TNNI3 (Ab-43) Antibody

Sign In for Pricing
View Details
Human ZNF649 activation kit by CRISPRa
GA112252 1 Kit

Human ZNF649 activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
FK506
SIH-214-50MG 50 mg

FK506

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details