Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfatase Modifying Factor 1/SUMF1 (C-6His)

Source: Human Cells. MW :38.27kD. Recombinant Human SUMF1 is produced by our Mammalian expression system and the target gene encoding Ser34-Asp374 is expressed with a 6His tag at the C-terminus. Human Sulfatase Modifying Factor 1 (SUMF1) is a 42kDa protein. SUMF1 is a Ca2+-binging member of the sulfatase-modifying factor family. SUMF1 is a soluble ER lumenal glycoprotein, it converts inactive sulfatases into an active form by transforming a catalytic site cysteine into a formylglycine residue. In the ER, SUMF1 can exist as either a monomer, or a disulfide-linked homodimer or a heterodimer with SUMF2. Three splice isoforms are known.

Product Specifications

Gene Name

SUMF1

Gene ID

285362

UniProt

Q8NBK3

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Cytokeratin 13 Antibody (KRT13/2659) [DyLight 755]
NBP3-08284IR 100 µL

Mouse Monoclonal Cytokeratin 13 Antibody (KRT13/2659) [DyLight 755]

Ask
View Details
Porcine Thymic Fibroblasts
ABC-TC020N 1 Vial

Porcine Thymic Fibroblasts

Ask
View Details
Anti-Salmonella enteritidis FliC Recombinant Nanobody (SAA2505)
JN148013-01 50 µg

Anti-Salmonella enteritidis FliC Recombinant Nanobody (SAA2505)

Ask
View Details
Anti-Salmonella enteritidis FliC Recombinant Nanobody (SAA2505)
JN148013-02 100 µg

Anti-Salmonella enteritidis FliC Recombinant Nanobody (SAA2505)

Ask
View Details
Anti-Salmonella enteritidis FliC Recombinant Nanobody (SAA2505)
JN148013-03 1 mg

Anti-Salmonella enteritidis FliC Recombinant Nanobody (SAA2505)

Ask
View Details
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (BSA & Azide Free) (MaxLight 490)
MBS6204422-01 0.1 mL

Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (BSA & Azide Free) (MaxLight 490)

Ask
View Details