Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin D/CSTD/CST5 (C-6His)

Source: Human Cells. MW :14.9kD. Recombinant Human Cystatin D is produced by our Mammalian expression system and the target gene encoding Gly21-Val142 is expressed with a 6His tag at the C-terminus. Cystatin-D is a protein that in humans is encoded by the CST5 gene. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity.

Product Specifications

Gene Name

CST5

Gene ID

1473

UniProt

P28325

Components

Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKVVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TEP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
46494121 3x 1.0µg DNA

TEP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
SPINK4 CRISPRa sgRNA lentivector (set of three targets)(Human)
45334121 3x 1.0µg DNA

SPINK4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
IDO1-IN-20
HY-146215 1 Each

IDO1-IN-20

Ask
View Details
SMC5 Immunizing Peptide
MBS426011-01 0.1 mg

SMC5 Immunizing Peptide

Ask
View Details
SMC5 Immunizing Peptide
MBS426011-02 5x 0.1 mg

SMC5 Immunizing Peptide

Ask
View Details