Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TREML1/TLT-1 (C-6His)

Source: Human Cells. MW :16.88kD. Recombinant Human TREML1 is produced by our Mammalian expression system and the target gene encoding Gln16-Pro162 is expressed with a 6His tag at the C-terminus. Triggering Receptor Expressed on Myeloid Cells-Like Protein 1 (TREML1) is a single-pass type I membrane protein. TREML1 precursor contains a 15 amino acid signal peptide, a 147 amino acid extracellular domain with an Ig-like V-type (immunoglobulin-like) domain, and 128 amino acid cytoplasmic domain. It can be expressed exclusively in platelets and megakaryocytes (MKs) . It is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML1 Sequestered in cytoplasmic vesicles in resting platelets. TREML1 be transported to the cell surface after stimulation by thrombin. Soluble fragments can be released into the serum by proteolysis. The phosphorylated TREML1 can interact with PTPN6 and PTPN11. TREML1 may participate in maintaining vascular hemostasis and regulating coagulation and inflammation at sites of injury.

Product Specifications

Gene Name

TREML1

Gene ID

340205

UniProt

Q86YW5

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human H4C7 Pre-designed siRNA Set A
SI006873A 1 Each

Human H4C7 Pre-designed siRNA Set A

Ask
View Details
Anti-6 His Antibody
18814-1 1 mg

Anti-6 His Antibody

Ask
View Details
AGO2 discontinued
385521 200 µL

AGO2 discontinued

Ask
View Details
Mouse CAAX prenyl protease 2 (RCE1) ELISA Kit
abx390419 96 Tests

Mouse CAAX prenyl protease 2 (RCE1) ELISA Kit

Ask
View Details
INT11/CPSF3L Polyclonal Antibody
MBS9235929-01 0.1 mL

INT11/CPSF3L Polyclonal Antibody

Ask
View Details
INT11/CPSF3L Polyclonal Antibody
MBS9235929-02 5x 0.1 mL

INT11/CPSF3L Polyclonal Antibody

Ask
View Details